TXNL4B purified MaxPab mouse polyclonal antibody (B02P)
  • TXNL4B purified MaxPab mouse polyclonal antibody (B02P)

TXNL4B purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00054957-B02P
TXNL4B purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TXNL4B protein.
Información adicional
Size 50 ug
Gene Name TXNL4B
Gene Alias DLP|Dim2|FLJ20511
Gene Description thioredoxin-like 4B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TXNL4B (NP_060323.1, 1 a.a. ~ 149 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54957

Enviar un mensaje


TXNL4B purified MaxPab mouse polyclonal antibody (B02P)

TXNL4B purified MaxPab mouse polyclonal antibody (B02P)