RNF125 monoclonal antibody (M01), clone 1A5
  • RNF125 monoclonal antibody (M01), clone 1A5

RNF125 monoclonal antibody (M01), clone 1A5

Ref: AB-H00054941-M01
RNF125 monoclonal antibody (M01), clone 1A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RNF125.
Información adicional
Size 100 ug
Gene Name RNF125
Gene Alias FLJ20456|MGC21737|TRAC1
Gene Description ring finger protein 125
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF125 (NP_060301, 143 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54941
Clone Number 1A5
Iso type IgG1 Kappa

Enviar un mensaje


RNF125 monoclonal antibody (M01), clone 1A5

RNF125 monoclonal antibody (M01), clone 1A5