RNF125 polyclonal antibody (A01)
  • RNF125 polyclonal antibody (A01)

RNF125 polyclonal antibody (A01)

Ref: AB-H00054941-A01
RNF125 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF125.
Información adicional
Size 50 uL
Gene Name RNF125
Gene Alias FLJ20456|MGC21737|TRAC1
Gene Description ring finger protein 125
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF125 (NP_060301, 143 a.a. ~ 231 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54941

Enviar un mensaje


RNF125 polyclonal antibody (A01)

RNF125 polyclonal antibody (A01)