ZNF434 MaxPab mouse polyclonal antibody (B02P)
  • ZNF434 MaxPab mouse polyclonal antibody (B02P)

ZNF434 MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00054925-B02P
ZNF434 MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF434 protein.
Información adicional
Size 50 ug
Gene Name ZNF434
Gene Alias FLJ20417|FLJ31901|MGC4179
Gene Description zinc finger protein 434
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAVKSTEAHPSSNKDPTQGQKSALQGNSPDSEASRQRFRQFCYQEVTGPHEAFSKLWELCCQWLRPKTHSKEEILELLVLEQFLTILPEEIQTWVREQHPENGEEAVALVEDVQRAPGQQVLDSEKDLKVLMKEMAPLGATRESLRSQWKQEVQPEEPTFKGSQSSHQRPGEQSEAWLAPQAPRNLPQNTGLHDQETGAVVWTAGSQGPAMRDNRAVSLCQQEWMCPGPAQRALYRGATQRKDSHVSLATGALG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF434 (AAH02859.1, 1 a.a. ~ 256 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54925

Enviar un mensaje


ZNF434 MaxPab mouse polyclonal antibody (B02P)

ZNF434 MaxPab mouse polyclonal antibody (B02P)