LIME1 MaxPab mouse polyclonal antibody (B01P)
  • LIME1 MaxPab mouse polyclonal antibody (B01P)

LIME1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054923-B01P
LIME1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LIME1 protein.
Información adicional
Size 50 ug
Gene Name LIME1
Gene Alias FLJ20406|LIME|LP8067|dJ583P15.4
Gene Description Lck interacting transmembrane adaptor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGLPVSWAPPALWVLGCCALLLSLWALCTACRRPEDAVAPRKRARRQRARLQGSATAAEASLLRRTHLCSLSKSDTRLHELHRGPRSSRALRPASMDLLRPHWLEVSRDITGPQAAPSAFPHQELPRALPAAAATAGCAGLEATYSNVGLAALPGVSLAASPVVAEYARVQKRKGTHRSPQEPQQGKTEVTPAAQVDVLYSRVCKPKRRDPGPTTDPLDPKGQGAILALAGDLAYQTLPLRALDVDSGPLENVYE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LIME1 (AAH17016.1, 1 a.a. ~ 295 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54923

Enviar un mensaje


LIME1 MaxPab mouse polyclonal antibody (B01P)

LIME1 MaxPab mouse polyclonal antibody (B01P)