DPP8 monoclonal antibody (M01), clone 1B10
  • DPP8 monoclonal antibody (M01), clone 1B10

DPP8 monoclonal antibody (M01), clone 1B10

Ref: AB-H00054878-M01
DPP8 monoclonal antibody (M01), clone 1B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DPP8.
Información adicional
Size 100 ug
Gene Name DPP8
Gene Alias DP8|DPRP1|FLJ14920|FLJ20283|MGC26191|MSTP141
Gene Description dipeptidyl-peptidase 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq IGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DPP8 (NP_932065.1, 161 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54878
Clone Number 1B10
Iso type IgG2a Kappa

Enviar un mensaje


DPP8 monoclonal antibody (M01), clone 1B10

DPP8 monoclonal antibody (M01), clone 1B10