DPP8 purified MaxPab mouse polyclonal antibody (B01P)
  • DPP8 purified MaxPab mouse polyclonal antibody (B01P)

DPP8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054878-B01P
DPP8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DPP8 protein.
Información adicional
Size 50 ug
Gene Name DPP8
Gene Alias DP8|DPRP1|FLJ14920|FLJ20283|MGC26191|MSTP141
Gene Description dipeptidyl-peptidase 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWKRSEQMKIKSGKCNMAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLRERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTREERRLTYVHNE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DPP8 (NP_932064.1, 1 a.a. ~ 898 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54878

Enviar un mensaje


DPP8 purified MaxPab mouse polyclonal antibody (B01P)

DPP8 purified MaxPab mouse polyclonal antibody (B01P)