QRICH1 MaxPab mouse polyclonal antibody (B01P)
  • QRICH1 MaxPab mouse polyclonal antibody (B01P)

QRICH1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054870-B01P
QRICH1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human QRICH1 protein.
Información adicional
Size 50 ug
Gene Name QRICH1
Gene Alias FLJ20259|MGC131838
Gene Description glutamine-rich 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGNCIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQVQVQVQQSPQQVSAQLSPQLTVHQPTEQPIQVQVQIQGQAPQSAAPSIQTPSLQSPSPSQLQAAQIQVQHVQAAQQIQAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSPPPSQQGSPREGERRVGTASVLQPVKKRKVDMPIT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen QRICH1 (NP_060200.2, 1 a.a. ~ 776 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54870

Enviar un mensaje


QRICH1 MaxPab mouse polyclonal antibody (B01P)

QRICH1 MaxPab mouse polyclonal antibody (B01P)