GPATC4 purified MaxPab mouse polyclonal antibody (B01P)
  • GPATC4 purified MaxPab mouse polyclonal antibody (B01P)

GPATC4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054865-B01P
GPATC4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GPATC4 protein.
Información adicional
Size 50 ug
Gene Name GPATCH4
Gene Alias GPATC4
Gene Description G patch domain containing 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MNVTPEVKSRGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFNKTAANLVVETGQDGVQIRSLSKETTRYNHPKPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSPKILTDEMLLQACEGRTAHKAARLGITMKAKLARLEAQEQAFLARLKGQDPGAPQLQSESKPPKKKKKKRRQKEEEEATASERNDADEKHPEHAEQNIRKSKKKKRRHQEGKVSDE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GPATC4 (AAH56904, 1 a.a. ~ 446 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54865

Enviar un mensaje


GPATC4 purified MaxPab mouse polyclonal antibody (B01P)

GPATC4 purified MaxPab mouse polyclonal antibody (B01P)