PAQR5 monoclonal antibody (M01), clone 1F4
  • PAQR5 monoclonal antibody (M01), clone 1F4

PAQR5 monoclonal antibody (M01), clone 1F4

Ref: AB-H00054852-M01
PAQR5 monoclonal antibody (M01), clone 1F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PAQR5.
Información adicional
Size 100 ug
Gene Name PAQR5
Gene Alias FLJ20190|MPRG
Gene Description progestin and adipoQ receptor family member V
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ESGVAAAREECLVSGLPVLSPRPVHWTPETLGTQDTIGETGHFTKDLTGM*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAQR5 (NP_060175, 1 a.a. ~ 51 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54852
Clone Number 1F4
Iso type IgG2a Kappa

Enviar un mensaje


PAQR5 monoclonal antibody (M01), clone 1F4

PAQR5 monoclonal antibody (M01), clone 1F4