ERCC6L monoclonal antibody (M01), clone 3F12-2B10
  • ERCC6L monoclonal antibody (M01), clone 3F12-2B10

ERCC6L monoclonal antibody (M01), clone 3F12-2B10

Ref: AB-H00054821-M01
ERCC6L monoclonal antibody (M01), clone 3F12-2B10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ERCC6L.
Información adicional
Size 100 ug
Gene Name ERCC6L
Gene Alias FLJ20105|MGC131695|PICH
Gene Description excision repair cross-complementing rodent repair deficiency, complementation group 6-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEKSFATKNEAVQKETLQEGPKQEALQEDPLESFNYVLSKSTKADIGPNLDQLKDDEILRHCNPWPIISITNESQNAESNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYACDFNLFLEDSADNRQNFSSQSLEHVEKENSLCGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRIVSDGEDEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPKNDISPPGRFFSSQIPSSVNKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERCC6L (AAH08808, 1 a.a. ~ 419 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54821
Clone Number 3F12-2B10
Iso type IgG2a kappa

Enviar un mensaje


ERCC6L monoclonal antibody (M01), clone 3F12-2B10

ERCC6L monoclonal antibody (M01), clone 3F12-2B10