ERCC6L purified MaxPab mouse polyclonal antibody (B01P)
  • ERCC6L purified MaxPab mouse polyclonal antibody (B01P)

ERCC6L purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054821-B01P
ERCC6L purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ERCC6L protein.
Información adicional
Size 50 ug
Gene Name ERCC6L
Gene Alias FLJ20105|MGC131695|PICH
Gene Description excision repair cross-complementing rodent repair deficiency, complementation group 6-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MEKSFATKNEAVQKETLQEGPKQEALQEDPLESFNYVLSKSTKADIGPNLDQLKDDEILRHCNPWPIISITNESQNAESNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYACDFNLFLEDSADNRQNFSSQSLEHVEKENSLCGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRIVSDGEDEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPKNDISPPGRFFSSQIPSSVNKS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ERCC6L (AAH08808.1, 1 a.a. ~ 419 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54821

Enviar un mensaje


ERCC6L purified MaxPab mouse polyclonal antibody (B01P)

ERCC6L purified MaxPab mouse polyclonal antibody (B01P)