GATAD2A polyclonal antibody (A01)
  • GATAD2A polyclonal antibody (A01)

GATAD2A polyclonal antibody (A01)

Ref: AB-H00054815-A01
GATAD2A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GATAD2A.
Información adicional
Size 50 uL
Gene Name GATAD2A
Gene Alias FLJ20085|FLJ21017|p66alpha
Gene Description GATA zinc finger domain containing 2A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPPPLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GATAD2A (NP_060130, 26 a.a. ~ 134 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54815

Enviar un mensaje


GATAD2A polyclonal antibody (A01)

GATAD2A polyclonal antibody (A01)