RNF111 purified MaxPab rabbit polyclonal antibody (D01P)
  • RNF111 purified MaxPab rabbit polyclonal antibody (D01P)

RNF111 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054778-D01P
RNF111 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RNF111 protein.
Información adicional
Size 100 ug
Gene Name RNF111
Gene Alias ARK|DKFZp313E0731|DKFZp686H1966|DKFZp761D081|FLJ38008
Gene Description ring finger protein 111
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MSQWTPEYKELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNCVKENQGILGLRQHLGTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSARSHKWPRTETESVSGLLMKRPCLHGSSLRRLPCRKRFVKNNSSQRTQKQKERILMQRKKREVLARRKYALLPSSSS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RNF111 (AAH60862.1, 1 a.a. ~ 985 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54778

Enviar un mensaje


RNF111 purified MaxPab rabbit polyclonal antibody (D01P)

RNF111 purified MaxPab rabbit polyclonal antibody (D01P)