DIRAS2 purified MaxPab mouse polyclonal antibody (B01P)
  • DIRAS2 purified MaxPab mouse polyclonal antibody (B01P)

DIRAS2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054769-B01P
DIRAS2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DIRAS2 protein.
Información adicional
Size 50 ug
Gene Name DIRAS2
Gene Alias DKFZp761C07121|Di-Ras2
Gene Description DIRAS family, GTP-binding RAS-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DIRAS2 (NP_060064.2, 1 a.a. ~ 199 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54769

Enviar un mensaje


DIRAS2 purified MaxPab mouse polyclonal antibody (B01P)

DIRAS2 purified MaxPab mouse polyclonal antibody (B01P)