DIRAS2 polyclonal antibody (A01)
  • DIRAS2 polyclonal antibody (A01)

DIRAS2 polyclonal antibody (A01)

Ref: AB-H00054769-A01
DIRAS2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DIRAS2.
Información adicional
Size 50 uL
Gene Name DIRAS2
Gene Alias DKFZp761C07121|Di-Ras2
Gene Description DIRAS family, GTP-binding RAS-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq AFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DIRAS2 (NP_060064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54769

Enviar un mensaje


DIRAS2 polyclonal antibody (A01)

DIRAS2 polyclonal antibody (A01)