BTG4 monoclonal antibody (M07), clone 1A6
  • BTG4 monoclonal antibody (M07), clone 1A6

BTG4 monoclonal antibody (M07), clone 1A6

Ref: AB-H00054766-M07
BTG4 monoclonal antibody (M07), clone 1A6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant BTG4.
Información adicional
Size 100 ug
Gene Name BTG4
Gene Alias MGC33003|PC3B
Gene Description B-cell translocation gene 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQVKSVPVLFYTFFLSNSKKNALIMKTKKQKNMERTKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BTG4 (AAH31045, 1 a.a. ~ 206 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54766
Clone Number 1A6
Iso type IgG2b Kappa

Enviar un mensaje


BTG4 monoclonal antibody (M07), clone 1A6

BTG4 monoclonal antibody (M07), clone 1A6