BTG4 purified MaxPab mouse polyclonal antibody (B01P)
  • BTG4 purified MaxPab mouse polyclonal antibody (B01P)

BTG4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054766-B01P
BTG4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BTG4 protein.
Información adicional
Size 50 ug
Gene Name BTG4
Gene Alias MGC33003|PC3B
Gene Description B-cell translocation gene 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQVKSVPVLFYTFFLSNSKKNALIMKTKKQKNMERTKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BTG4 (AAH31045.1, 1 a.a. ~ 206 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54766

Enviar un mensaje


BTG4 purified MaxPab mouse polyclonal antibody (B01P)

BTG4 purified MaxPab mouse polyclonal antibody (B01P)