ROPN1 monoclonal antibody (M04), clone 1B10
  • ROPN1 monoclonal antibody (M04), clone 1B10

ROPN1 monoclonal antibody (M04), clone 1B10

Ref: AB-H00054763-M04
ROPN1 monoclonal antibody (M04), clone 1B10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ROPN1.
Información adicional
Size 100 ug
Gene Name ROPN1
Gene Alias DKFZp434B1222|ODF6|RHPNAP1|ROPN1A|ropporin
Gene Description ropporin, rhophilin associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ROPN1 (AAH15413, 1 a.a. ~ 120 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54763
Clone Number 1B10
Iso type IgG2a Kappa

Enviar un mensaje


ROPN1 monoclonal antibody (M04), clone 1B10

ROPN1 monoclonal antibody (M04), clone 1B10