RAB39 purified MaxPab mouse polyclonal antibody (B01P)
  • RAB39 purified MaxPab mouse polyclonal antibody (B01P)

RAB39 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054734-B01P
RAB39 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAB39 protein.
Información adicional
Size 50 ug
Gene Name RAB39
Gene Alias -
Gene Description RAB39, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq METIWIYQFRLIVIGDSTVGKSCLLRRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNAVHSSEEAVKPRKECFC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB39 (AAH28064, 1 a.a. ~ 217 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54734

Enviar un mensaje


RAB39 purified MaxPab mouse polyclonal antibody (B01P)

RAB39 purified MaxPab mouse polyclonal antibody (B01P)