SLC6A20 monoclonal antibody (M02), clone 3G6
  • SLC6A20 monoclonal antibody (M02), clone 3G6

SLC6A20 monoclonal antibody (M02), clone 3G6

Ref: AB-H00054716-M02
SLC6A20 monoclonal antibody (M02), clone 3G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC6A20.
Información adicional
Size 100 ug
Gene Name SLC6A20
Gene Alias MGC161475|SIT1|XT3|Xtrp3
Gene Description solute carrier family 6 (proline IMINO transporter), member 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC6A20 (NP_064593, 301 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54716
Clone Number 3G6
Iso type IgG1 Kappa

Enviar un mensaje


SLC6A20 monoclonal antibody (M02), clone 3G6

SLC6A20 monoclonal antibody (M02), clone 3G6