SLC6A20 polyclonal antibody (A01)
  • SLC6A20 polyclonal antibody (A01)

SLC6A20 polyclonal antibody (A01)

Ref: AB-H00054716-A01
SLC6A20 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC6A20.
Información adicional
Size 50 uL
Gene Name SLC6A20
Gene Alias MGC161475|SIT1|XT3|Xtrp3
Gene Description solute carrier family 6 (proline IMINO transporter), member 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC6A20 (NP_064593, 301 a.a. ~ 369 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54716

Enviar un mensaje


SLC6A20 polyclonal antibody (A01)

SLC6A20 polyclonal antibody (A01)