ATPBD1B purified MaxPab mouse polyclonal antibody (B03P)
  • ATPBD1B purified MaxPab mouse polyclonal antibody (B03P)

ATPBD1B purified MaxPab mouse polyclonal antibody (B03P)

Ref: AB-H00054707-B03P
ATPBD1B purified MaxPab mouse polyclonal antibody (B03P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ATPBD1B protein.
Información adicional
Size 50 ug
Gene Name GPN2
Gene Alias ATPBD1B|FLJ10349
Gene Description GPN-loop GTPase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAGAAPTTAFGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELVGLGDVMDALRLGPNGGLLYCMEYLEANLDWLRAKLDPLRGHYFLFDCPGQVELCTHHGALRSIFSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHINLLSKMDLIEHYGKLAFNLDYYTEVLDLSYLLDHLASDPFFRHYRQLNEKLVRLIEDYSLVSFIPLNIQDKESIQRVLQAV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ATPBD1B (AAH08634.1, 1 a.a. ~ 310 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54707

Enviar un mensaje


ATPBD1B purified MaxPab mouse polyclonal antibody (B03P)

ATPBD1B purified MaxPab mouse polyclonal antibody (B03P)