RRN3 monoclonal antibody (M01), clone 3H5
  • RRN3 monoclonal antibody (M01), clone 3H5

RRN3 monoclonal antibody (M01), clone 3H5

Ref: AB-H00054700-M01
RRN3 monoclonal antibody (M01), clone 3H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RRN3.
Información adicional
Size 100 ug
Gene Name RRN3
Gene Alias DKFZp566E104|MGC104238|TIFIA
Gene Description RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CYTIIERNNRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKRSKKFIDPIYQVWEDMSAEELQEFKKPMKKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RRN3 (NP_060897, 525 a.a. ~ 631 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54700
Clone Number 3H5
Iso type IgG1 Kappa

Enviar un mensaje


RRN3 monoclonal antibody (M01), clone 3H5

RRN3 monoclonal antibody (M01), clone 3H5