RRN3 purified MaxPab mouse polyclonal antibody (B01P)
  • RRN3 purified MaxPab mouse polyclonal antibody (B01P)

RRN3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054700-B01P
RRN3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RRN3 protein.
Información adicional
Size 50 ug
Gene Name RRN3
Gene Alias DKFZp566E104|MGC104238|TIFIA
Gene Description RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MRALENDFFNSPPRKTVRFGGTVTEVLLKYKKGETNDFELLKNQLLDPDIKDDQIINWLLEFRSSVMYLTKDFEQLISIILRLPWLNRSQTVVEEYLAFLGNLVSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RRN3 (ENSP00000219758, 1 a.a. ~ 106 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54700

Enviar un mensaje


RRN3 purified MaxPab mouse polyclonal antibody (B01P)

RRN3 purified MaxPab mouse polyclonal antibody (B01P)