RRN3 polyclonal antibody (A01)
  • RRN3 polyclonal antibody (A01)

RRN3 polyclonal antibody (A01)

Ref: AB-H00054700-A01
RRN3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RRN3.
Información adicional
Size 50 uL
Gene Name RRN3
Gene Alias DKFZp566E104|MGC104238|TIFIA
Gene Description RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq CYTIIERNNRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKRSKKFIDPIYQVWEDMSAEELQEFKKPMKKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RRN3 (NP_060897, 525 a.a. ~ 631 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54700

Enviar un mensaje


RRN3 polyclonal antibody (A01)

RRN3 polyclonal antibody (A01)