C1orf181 purified MaxPab mouse polyclonal antibody (B01P)
  • C1orf181 purified MaxPab mouse polyclonal antibody (B01P)

C1orf181 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054680-B01P
C1orf181 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C1orf181 protein.
Información adicional
Size 50 ug
Gene Name ZNHIT6
Gene Alias BCD1|C1orf181|FLJ20729|FLJ20760|MGC131963|NY-BR-75
Gene Description zinc finger, HIT type 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEFAAENEGKSGGGLHSVAEGVRLSPEPGREGVRDLAGAEEFGGGEEGTGLTGIKEIGDGEEGSGQRPEEIPMDLTVVKQEIIDWPGTEGRLAGQWVEQEVEDRPEVKDENAGVLEVKQETDSSLVVKEAKVGEPEVKEEKVKEEVMDWSEVKEEKDNLEIKQEEKFVGQCIKEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C1orf181 (AAH26236.1, 1 a.a. ~ 470 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54680

Enviar un mensaje


C1orf181 purified MaxPab mouse polyclonal antibody (B01P)

C1orf181 purified MaxPab mouse polyclonal antibody (B01P)