GTPBP2 purified MaxPab mouse polyclonal antibody (B01P)
  • GTPBP2 purified MaxPab mouse polyclonal antibody (B01P)

GTPBP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054676-B01P
GTPBP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GTPBP2 protein.
Información adicional
Size 50 ug
Gene Name GTPBP2
Gene Alias MGC74725
Gene Description GTP binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDSRVSELFGGCCRPGGGPAVGGTLKARGAGSSSGCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVPDNQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYSDSRTAEEICESSSKM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GTPBP2 (NP_061969.3, 1 a.a. ~ 602 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54676

Enviar un mensaje


GTPBP2 purified MaxPab mouse polyclonal antibody (B01P)

GTPBP2 purified MaxPab mouse polyclonal antibody (B01P)