HES2 monoclonal antibody (M06), clone 2F4
  • HES2 monoclonal antibody (M06), clone 2F4

HES2 monoclonal antibody (M06), clone 2F4

Ref: AB-H00054626-M06
HES2 monoclonal antibody (M06), clone 2F4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant HES2.
Información adicional
Size 100 ug
Gene Name HES2
Gene Alias bHLHb40
Gene Description hairy and enhancer of split 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HES2 (NP_061962, 41 a.a. ~ 114 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54626
Clone Number 2F4
Iso type IgG2b Kappa

Enviar un mensaje


HES2 monoclonal antibody (M06), clone 2F4

HES2 monoclonal antibody (M06), clone 2F4