DDX56 monoclonal antibody (M05), clone 4C5
  • DDX56 monoclonal antibody (M05), clone 4C5

DDX56 monoclonal antibody (M05), clone 4C5

Ref: AB-H00054606-M05
DDX56 monoclonal antibody (M05), clone 4C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DDX56.
Información adicional
Size 100 ug
Gene Name DDX56
Gene Alias DDX21|DDX26|NOH61
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 56
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq IKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPPALRGLVRPHKKRKKLSSSCRKAKRAKSQNPLRSFKHKGKKFRPTAKPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDX56 (NP_061955, 450 a.a. ~ 547 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54606
Clone Number 4C5
Iso type IgG2a Kappa

Enviar un mensaje


DDX56 monoclonal antibody (M05), clone 4C5

DDX56 monoclonal antibody (M05), clone 4C5