DDX56 purified MaxPab rabbit polyclonal antibody (D01P)
  • DDX56 purified MaxPab rabbit polyclonal antibody (D01P)

DDX56 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054606-D01P
DDX56 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DDX56 protein.
Información adicional
Size 100 ug
Gene Name DDX56
Gene Alias DDX21|DDX26|NOH61
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 56
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEDSEALGFEHMGLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGKTAAYAIPMLQLLLHRKATGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVVVGTPSRILSHLQQDSLKLRDSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNEDVQALKELILHNPVTLKLQESQLPGPDQLQQFQVVCETEEDKFLLLYALLKLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DDX56 (NP_061955.1, 1 a.a. ~ 547 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54606

Enviar un mensaje


DDX56 purified MaxPab rabbit polyclonal antibody (D01P)

DDX56 purified MaxPab rabbit polyclonal antibody (D01P)