LZTFL1 monoclonal antibody (M09), clone 1B1
  • LZTFL1 monoclonal antibody (M09), clone 1B1

LZTFL1 monoclonal antibody (M09), clone 1B1

Ref: AB-H00054585-M09
LZTFL1 monoclonal antibody (M09), clone 1B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LZTFL1.
Información adicional
Size 100 ug
Gene Name LZTFL1
Gene Alias FLJ36386
Gene Description leucine zipper transcription factor-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq LKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENQELLEQVAEFEKA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LZTFL1 (AAH25988.1, 39 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54585
Clone Number 1B1
Iso type IgG2a Kappa

Enviar un mensaje


LZTFL1 monoclonal antibody (M09), clone 1B1

LZTFL1 monoclonal antibody (M09), clone 1B1