LZTFL1 polyclonal antibody (A01)
  • LZTFL1 polyclonal antibody (A01)

LZTFL1 polyclonal antibody (A01)

Ref: AB-H00054585-A01
LZTFL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LZTFL1.
Información adicional
Size 50 uL
Gene Name LZTFL1
Gene Alias FLJ36386
Gene Description leucine zipper transcription factor-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LZTFL1 (NP_065080, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54585

Enviar un mensaje


LZTFL1 polyclonal antibody (A01)

LZTFL1 polyclonal antibody (A01)