Ver mas grande
EGLN1 polyclonal antibody (A01)
AB-H00054583-A01
Producto nuevo
EGLN1 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | EGLN1 |
| Gene Alias | C1orf12|DKFZp761F179|ECYT3|HIFPH2|HPH2|PHD2|SM-20|SM20|ZMYND6 |
| Gene Description | egl nine homolog 1 (C. elegans) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | LMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFAD |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | EGLN1 (NP_071334, 272 a.a. ~ 355 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 54583 |
Más información
Mouse polyclonal antibody raised against a partial recombinant EGLN1.