EGLN1 polyclonal antibody (A01)
  • EGLN1 polyclonal antibody (A01)

EGLN1 polyclonal antibody (A01)

Ref: AB-H00054583-A01
EGLN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EGLN1.
Información adicional
Size 50 uL
Gene Name EGLN1
Gene Alias C1orf12|DKFZp761F179|ECYT3|HIFPH2|HPH2|PHD2|SM-20|SM20|ZMYND6
Gene Description egl nine homolog 1 (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFAD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EGLN1 (NP_071334, 272 a.a. ~ 355 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54583

Enviar un mensaje


EGLN1 polyclonal antibody (A01)

EGLN1 polyclonal antibody (A01)