SGTB purified MaxPab mouse polyclonal antibody (B01P)
  • SGTB purified MaxPab mouse polyclonal antibody (B01P)

SGTB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054557-B01P
SGTB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SGTB protein.
Información adicional
Size 50 ug
Gene Name SGTB
Gene Alias FLJ39002|SGT2
Gene Description small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNPAFISMAASLMQNPQVQQLMSGMMTNAIGGPAAG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SGTB (NP_061945.1, 1 a.a. ~ 304 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54557

Enviar un mensaje


SGTB purified MaxPab mouse polyclonal antibody (B01P)

SGTB purified MaxPab mouse polyclonal antibody (B01P)