ING3 monoclonal antibody (M13A), clone 2E21
  • ING3 monoclonal antibody (M13A), clone 2E21

ING3 monoclonal antibody (M13A), clone 2E21

Ref: AB-H00054556-M13A
ING3 monoclonal antibody (M13A), clone 2E21

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ING3.
Información adicional
Size 200 uL
Gene Name ING3
Gene Alias Eaf4|FLJ20089|ING2|p47ING3
Gene Description inhibitor of growth family, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ING3 (NP_938008, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 54556
Clone Number 2E21
Iso type IgG2a Kappa

Enviar un mensaje


ING3 monoclonal antibody (M13A), clone 2E21

ING3 monoclonal antibody (M13A), clone 2E21