ING3 polyclonal antibody (A01)
  • ING3 polyclonal antibody (A01)

ING3 polyclonal antibody (A01)

Ref: AB-H00054556-A01
ING3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ING3.
Información adicional
Size 50 uL
Gene Name ING3
Gene Alias Eaf4|FLJ20089|ING2|p47ING3
Gene Description inhibitor of growth family, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ING3 (NP_938008, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54556

Enviar un mensaje


ING3 polyclonal antibody (A01)

ING3 polyclonal antibody (A01)