NDUFB11 monoclonal antibody (M12), clone 1D6
  • NDUFB11 monoclonal antibody (M12), clone 1D6

NDUFB11 monoclonal antibody (M12), clone 1D6

Ref: AB-H00054539-M12
NDUFB11 monoclonal antibody (M12), clone 1D6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NDUFB11.
Información adicional
Size 100 ug
Gene Name NDUFB11
Gene Alias ESSS|FLJ20494|MGC111182|NP17.3|Np15|P17.3
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFB11 (AAH10665, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54539
Clone Number 1D6
Iso type IgG2b Kappa

Enviar un mensaje


NDUFB11 monoclonal antibody (M12), clone 1D6

NDUFB11 monoclonal antibody (M12), clone 1D6