DDX4 monoclonal antibody (M06), clone 3D5
  • DDX4 monoclonal antibody (M06), clone 3D5

DDX4 monoclonal antibody (M06), clone 3D5

Ref: AB-H00054514-M06
DDX4 monoclonal antibody (M06), clone 3D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DDX4.
Información adicional
Size 100 ug
Gene Name DDX4
Gene Alias MGC111074|VASA
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDDESWD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDX4 (NP_061912.1, 625 a.a. ~ 724 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54514
Clone Number 3D5
Iso type IgG2a Kappa

Enviar un mensaje


DDX4 monoclonal antibody (M06), clone 3D5

DDX4 monoclonal antibody (M06), clone 3D5