RHOF purified MaxPab mouse polyclonal antibody (B01P)
  • RHOF purified MaxPab mouse polyclonal antibody (B01P)

RHOF purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054509-B01P
RHOF purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RHOF protein.
Información adicional
Size 50 ug
Gene Name RHOF
Gene Alias ARHF|FLJ20247|RIF
Gene Description ras homolog gene family, member F (in filopodia)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMQVGRGQDPGAQPWL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RHOF (AAH18208.1, 1 a.a. ~ 170 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54509

Enviar un mensaje


RHOF purified MaxPab mouse polyclonal antibody (B01P)

RHOF purified MaxPab mouse polyclonal antibody (B01P)