DGCR8 MaxPab rabbit polyclonal antibody (D01)
  • DGCR8 MaxPab rabbit polyclonal antibody (D01)

DGCR8 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00054487-D01
DGCR8 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DGCR8 protein.
Información adicional
Size 100 uL
Gene Name DGCR8
Gene Alias C22orf12|DGCRK6|Gy1
Gene Description DiGeorge syndrome critical region gene 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSELPAEDPFNFYGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDALLEEGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DGCR8 (NP_073557.3, 1 a.a. ~ 773 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 54487

Enviar un mensaje


DGCR8 MaxPab rabbit polyclonal antibody (D01)

DGCR8 MaxPab rabbit polyclonal antibody (D01)