MRPS21 monoclonal antibody (M03), clone 1C5
  • MRPS21 monoclonal antibody (M03), clone 1C5

MRPS21 monoclonal antibody (M03), clone 1C5

Ref: AB-H00054460-M03
MRPS21 monoclonal antibody (M03), clone 1C5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MRPS21.
Información adicional
Size 100 ug
Gene Name MRPS21
Gene Alias MDS016|MRP-S21|RPMS21
Gene Description mitochondrial ribosomal protein S21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MRPS21 (AAH04566, 1 a.a. ~ 87 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54460
Clone Number 1C5
Iso type IgG2b Kappa

Enviar un mensaje


MRPS21 monoclonal antibody (M03), clone 1C5

MRPS21 monoclonal antibody (M03), clone 1C5