FBXO42 polyclonal antibody (A01)
  • FBXO42 polyclonal antibody (A01)

FBXO42 polyclonal antibody (A01)

Ref: AB-H00054455-A01
FBXO42 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBXO42.
Información adicional
Size 50 uL
Gene Name FBXO42
Gene Alias Fbx42|KIAA1332
Gene Description F-box protein 42
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXO42 (NP_061867, 619 a.a. ~ 717 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54455

Enviar un mensaje


FBXO42 polyclonal antibody (A01)

FBXO42 polyclonal antibody (A01)