GFOD1 purified MaxPab mouse polyclonal antibody (B01P)
  • GFOD1 purified MaxPab mouse polyclonal antibody (B01P)

GFOD1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054438-B01P
GFOD1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GFOD1 protein.
Información adicional
Size 50 ug
Gene Name GFOD1
Gene Alias -
Gene Description glucose-fructose oxidoreductase domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLPGVGVFGTSLTARVIIPLLKDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCINLPPPLTRQIAVKTLGIGKNVICDRTATPLDAFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYVGEPLVCEVQVHGGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GFOD1 (NP_061861.1, 1 a.a. ~ 390 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54438

Enviar un mensaje


GFOD1 purified MaxPab mouse polyclonal antibody (B01P)

GFOD1 purified MaxPab mouse polyclonal antibody (B01P)