Ver mas grande
DNAJC10 monoclonal antibody (M02A), clone 3A8
AB-H00054431-M02A
Producto nuevo
DNAJC10 monoclonal antibody (M02A), clone 3A8
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | DNAJC10 |
| Gene Alias | DKFZp434J1813|ERdj5|JPDI|MGC104194 |
| Gene Description | DnaJ (Hsp40) homolog, subfamily C, member 10 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Ce,WB-Re,ELISA |
| Immunogen Prot. Seq | KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | DNAJC10 (NP_061854, 688 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 54431 |
| Clone Number | 3A8 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant DNAJC10.