DNAJC10 polyclonal antibody (A01)
  • DNAJC10 polyclonal antibody (A01)

DNAJC10 polyclonal antibody (A01)

Ref: AB-H00054431-A01
DNAJC10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DNAJC10.
Información adicional
Size 50 uL
Gene Name DNAJC10
Gene Alias DKFZp434J1813|ERdj5|JPDI|MGC104194
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DNAJC10 (NP_061854, 688 a.a. ~ 793 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54431

Enviar un mensaje


DNAJC10 polyclonal antibody (A01)

DNAJC10 polyclonal antibody (A01)