NLGN3 polyclonal antibody (A01)
  • NLGN3 polyclonal antibody (A01)

NLGN3 polyclonal antibody (A01)

Ref: AB-H00054413-A01
NLGN3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NLGN3.
Información adicional
Size 50 uL
Gene Name NLGN3
Gene Alias ASPGX1|AUTSX1|HNL3|KIAA1480
Gene Description neuroligin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPNGKTWSTKRPAISPAYSNENAQGSWNGDQDAGPLLVENPRDYSTELS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NLGN3 (NP_061850, 590 a.a. ~ 689 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54413

Enviar un mensaje


NLGN3 polyclonal antibody (A01)

NLGN3 polyclonal antibody (A01)