SOX18 monoclonal antibody (M05), clone 1C4
  • SOX18 monoclonal antibody (M05), clone 1C4

SOX18 monoclonal antibody (M05), clone 1C4

Ref: AB-H00054345-M05
SOX18 monoclonal antibody (M05), clone 1C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SOX18.
Información adicional
Size 100 ug
Gene Name SOX18
Gene Alias HLTS
Gene Description SRY (sex determining region Y)-box 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq EPGRYGLSPAGRGERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLRVQHLRDHP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX18 (NP_060889, 63 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54345
Clone Number 1C4
Iso type IgG2a Kappa

Enviar un mensaje


SOX18 monoclonal antibody (M05), clone 1C4

SOX18 monoclonal antibody (M05), clone 1C4