GDAP1 polyclonal antibody (A01)
  • GDAP1 polyclonal antibody (A01)

GDAP1 polyclonal antibody (A01)

Ref: AB-H00054332-A01
GDAP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GDAP1.
Información adicional
Size 50 uL
Gene Name GDAP1
Gene Alias -
Gene Description ganglioside-induced differentiation-associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GDAP1 (NP_061845, 158 a.a. ~ 257 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54332

Enviar un mensaje


GDAP1 polyclonal antibody (A01)

GDAP1 polyclonal antibody (A01)