GNG2 monoclonal antibody (M03), clone 4C8
  • GNG2 monoclonal antibody (M03), clone 4C8

GNG2 monoclonal antibody (M03), clone 4C8

Ref: AB-H00054331-M03
GNG2 monoclonal antibody (M03), clone 4C8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant GNG2.
Información adicional
Size 100 ug
Gene Name GNG2
Gene Alias -
Gene Description guanine nucleotide binding protein (G protein), gamma 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GNG2 (AAH20774, 1 a.a. ~ 71 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54331
Clone Number 4C8
Iso type IgG1 Kappa

Enviar un mensaje


GNG2 monoclonal antibody (M03), clone 4C8

GNG2 monoclonal antibody (M03), clone 4C8